Lineage for d6ew7a_ (6ew7 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513278Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2513279Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 2513280Species Human (Homo sapiens) [TaxId:9606] [102923] (24 PDB entries)
  8. 3059189Domain d6ew7a_: 6ew7 A: [359251]
    automated match to d1r29a_
    complexed with c1w, cl

Details for d6ew7a_

PDB Entry: 6ew7 (more details), 1.6 Å

PDB Description: crystal structure of the bcl6 btb domain in complex with anilinopyrimidine ligand
PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d6ew7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ew7a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as

SCOPe Domain Coordinates for d6ew7a_:

Click to download the PDB-style file with coordinates for d6ew7a_.
(The format of our PDB-style files is described here.)

Timeline for d6ew7a_:

  • d6ew7a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25