Lineage for d6fhka1 (6fhk A:4-188)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2460926Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2461192Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [53071] (7 PDB entries)
  8. 3059185Domain d6fhka1: 6fhk A:4-188 [359247]
    automated match to d1hjoa1
    complexed with adp, k, mg, po4, sep

Details for d6fhka1

PDB Entry: 6fhk (more details), 1.66 Å

PDB Description: structure of a modified protein containing a genetically encoded phosphoserine
PDB Compounds: (A:) heat shock 70 kda protein 1a

SCOPe Domain Sequences for d6fhka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fhka1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]}
aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
qnsvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
gldrt

SCOPe Domain Coordinates for d6fhka1:

Click to download the PDB-style file with coordinates for d6fhka1.
(The format of our PDB-style files is described here.)

Timeline for d6fhka1:

  • d6fhka1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25

View in 3D
Domains from same chain:
(mouse over for more information)
d6fhka2