SCOPe 2.08: Domain d6enpa1: 6enp A:1-127

Lineage for d6enpa1 (6enp A:1-127)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.0: automated matches [191478] (1 protein)
   not a true family

6. Protein automated matches [190767] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255211] (6 PDB entries)

8. Domain d6enpa1: 6enp A:1-127 [359235]
   Other proteins in same PDB: d6enpa2
   automated match to d4x09a_
   complexed with cl, na, po4, zn

Details for d6enpa1

PDB Entry: 6enp, 1.04 Å

PDB Description: atomic resolution structure of human rnase 6 in the presence of phosphate anions in p21 space group.

PDB Compounds: (A:) Ribonuclease K6

SCOPe Domain Sequences for d6enpa1:

Sequence; same for both SEQRES and ATOM records:

>d6enpa1 d.5.1.0 (A:1-127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdllsi
vcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklvp
vhldsil

Timeline for d6enpa1:

• d6enpa1 first appeared in SCOPe 2.07, called d6enpa_