SCOPe 2.08: Domain d6dfil2: 6dfi L:107-213

Lineage for d6dfil2 (6dfi L:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6dfil2: 6dfi L:107-213 [359222]
   Other proteins in same PDB: d6dfie_, d6dfih1, d6dfih2, d6dfil1
   automated match to d1dn0a2

Details for d6dfil2

PDB Entry: 6dfi, 2.48 Å

PDB Description: crystal structure of anti-zika antibody z021 bound to zika virus envelope protein diii

PDB Compounds: (L:) anti-Zika antibody Z021, Light Chain

SCOPe Domain Sequences for d6dfil2:

Sequence; same for both SEQRES and ATOM records:

>d6dfil2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6dfil2:

• d6dfil2 first appeared in SCOPe 2.07