Lineage for d6ddva2 (6ddv A:108-212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (670 PDB entries)
  8. 3059156Domain d6ddva2: 6ddv A:108-212 [359218]
    Other proteins in same PDB: d6ddva1
    automated match to d1t66c2

Details for d6ddva2

PDB Entry: 6ddv (more details), 2.05 Å

PDB Description: crystal structure analysis of the epitope of an anti-mica antibody
PDB Compounds: (A:) Anti-MICA Fab fragment light chain clone 6E1

SCOPe Domain Sequences for d6ddva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ddva2 b.1.1.0 (A:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d6ddva2:

Click to download the PDB-style file with coordinates for d6ddva2.
(The format of our PDB-style files is described here.)

Timeline for d6ddva2:

  • d6ddva2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25