SCOPe 2.08: Domain d6ddva2: 6ddv A:108-212

Lineage for d6ddva2 (6ddv A:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6ddva2: 6ddv A:108-212 [359218]
   Other proteins in same PDB: d6ddva1
   automated match to d1t66c2

Details for d6ddva2

PDB Entry: 6ddv, 2.05 Å

PDB Description: crystal structure analysis of the epitope of an anti-mica antibody

PDB Compounds: (A:) Anti-MICA Fab fragment light chain clone 6E1

SCOPe Domain Sequences for d6ddva2:

Sequence; same for both SEQRES and ATOM records:

>d6ddva2 b.1.1.0 (A:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d6ddva2:

• d6ddva2 first appeared in SCOPe 2.07