Lineage for d6ddva1 (6ddv A:1-107)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347951Species Mouse (Mus musculus) [TaxId:10090] [186842] (161 PDB entries)
  8. 3059155Domain d6ddva1: 6ddv A:1-107 [359217]
    Other proteins in same PDB: d6ddva2
    automated match to d1t66c1

Details for d6ddva1

PDB Entry: 6ddv (more details), 2.05 Å

PDB Description: crystal structure analysis of the epitope of an anti-mica antibody
PDB Compounds: (A:) Anti-MICA Fab fragment light chain clone 6E1

SCOPe Domain Sequences for d6ddva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ddva1 b.1.1.1 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqhivhsnentylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleik

SCOPe Domain Coordinates for d6ddva1:

Click to download the PDB-style file with coordinates for d6ddva1.
(The format of our PDB-style files is described here.)

Timeline for d6ddva1:

  • d6ddva1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25