Lineage for d1dluc2 (1dlu C:269-392)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75535Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 75536Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 75537Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 75597Protein Biosynthetic thiolase [53905] (1 species)
  7. 75598Species Zoogloea ramigera [TaxId:350] [53906] (4 PDB entries)
  8. 75620Domain d1dluc2: 1dlu C:269-392 [35921]

Details for d1dluc2

PDB Entry: 1dlu (more details), 2.25 Å

PDB Description: unliganded biosynthetic thiolase from zoogloea ramigera

SCOP Domain Sequences for d1dluc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dluc2 c.95.1.1 (C:269-392) Biosynthetic thiolase {Zoogloea ramigera}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOP Domain Coordinates for d1dluc2:

Click to download the PDB-style file with coordinates for d1dluc2.
(The format of our PDB-style files is described here.)

Timeline for d1dluc2: