Lineage for d6dfie_ (6dfi E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362223Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2362267Protein automated matches [190183] (8 species)
    not a true protein
  7. 2362287Species Zika virus [TaxId:64320] [320471] (6 PDB entries)
  8. 3059145Domain d6dfie_: 6dfi E: [359207]
    Other proteins in same PDB: d6dfil1, d6dfil2
    automated match to d5omza_

Details for d6dfie_

PDB Entry: 6dfi (more details), 2.48 Å

PDB Description: crystal structure of anti-zika antibody z021 bound to zika virus envelope protein diii
PDB Compounds: (E:) Zika virus envelope protein DIII

SCOPe Domain Sequences for d6dfie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dfie_ b.1.18.4 (E:) automated matches {Zika virus [TaxId: 64320]}
vsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitan
pvitestenskmmleldppfgdsyivigvgekkithhwhrsg

SCOPe Domain Coordinates for d6dfie_:

Click to download the PDB-style file with coordinates for d6dfie_.
(The format of our PDB-style files is described here.)

Timeline for d6dfie_:

  • d6dfie_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25