SCOPe 2.08: Domain d6dfie_: 6dfi E:

Lineage for d6dfie_ (6dfi E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (10 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [320471] (7 PDB entries)

8. Domain d6dfie_: 6dfi E: [359207]
   Other proteins in same PDB: d6dfih1, d6dfih2, d6dfil1, d6dfil2
   automated match to d5omza_

Details for d6dfie_

PDB Entry: 6dfi, 2.48 Å

PDB Description: crystal structure of anti-zika antibody z021 bound to zika virus envelope protein diii

PDB Compounds: (E:) Zika virus envelope protein DIII

SCOPe Domain Sequences for d6dfie_:

Sequence; same for both SEQRES and ATOM records:

>d6dfie_ b.1.18.4 (E:) automated matches {Zika virus [TaxId: 64320]}
vsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitan
pvitestenskmmleldppfgdsyivigvgekkithhwhrsg

Timeline for d6dfie_:

• d6dfie_ first appeared in SCOPe 2.07