Lineage for d6cw4a_ (6cw4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325440Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 2325441Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 2325488Family a.61.1.4: GAG polyprotein M-domain [47848] (2 proteins)
    the C-terminal helix region is missing(?)
    automatically mapped to Pfam PF02813
  6. 2325492Protein automated matches [336961] (2 species)
    not a true protein
  7. 3059126Species Rous sarcoma virus [TaxId:11888] [359188] (4 PDB entries)
  8. 3059133Domain d6cw4a_: 6cw4 A: [359195]
    automated match to d1a6sa_
    complexed with fgv

Details for d6cw4a_

PDB Entry: 6cw4 (more details)

PDB Description: haddock structure of the rous sarcoma virus matrix protein (m-domain) in complex with inositol 1,3,5-trisphosphate
PDB Compounds: (A:) Matrix protein p19

SCOPe Domain Sequences for d6cw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cw4a_ a.61.1.4 (A:) automated matches {Rous sarcoma virus [TaxId: 11888]}
seavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsq
ramilgksgelktwglvlgalkaaree

SCOPe Domain Coordinates for d6cw4a_:

Click to download the PDB-style file with coordinates for d6cw4a_.
(The format of our PDB-style files is described here.)

Timeline for d6cw4a_:

  • d6cw4a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25