Lineage for d6ctca1 (6ctc A:3-333)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (147 species)
    not a true protein
  7. 2487651Species Human (Homo sapiens) [TaxId:9606] [193730] (32 PDB entries)
  8. 3059131Domain d6ctca1: 6ctc A:3-333 [359193]
    automated match to d4h0wa1
    complexed with co3, fe, pop

Details for d6ctca1

PDB Entry: 6ctc (more details), 2.6 Å

PDB Description: crystal structure of human transferrin bound to triferic fpc iron pyrophosphate
PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d6ctca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ctca1 c.94.1.0 (A:3-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtcpe

SCOPe Domain Coordinates for d6ctca1:

Click to download the PDB-style file with coordinates for d6ctca1.
(The format of our PDB-style files is described here.)

Timeline for d6ctca1:

  • d6ctca1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25

View in 3D
Domains from same chain:
(mouse over for more information)
d6ctca2