Lineage for d6ccja1 (6ccj A:2-87)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325440Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 2325441Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 2325488Family a.61.1.4: GAG polyprotein M-domain [47848] (2 proteins)
    the C-terminal helix region is missing(?)
    automatically mapped to Pfam PF02813
  6. 2325492Protein automated matches [336961] (2 species)
    not a true protein
  7. 2325493Species Rous sarcoma virus (strain prague c) [TaxId:11888] [336962] (3 PDB entries)
  8. 3059120Domain d6ccja1: 6ccj A:2-87 [359182]
    Other proteins in same PDB: d6ccja2
    automated match to d1a6sa_

Details for d6ccja1

PDB Entry: 6ccj (more details)

PDB Description: nmr structure of the rous sarcoma virus matrix protein (m domain)
PDB Compounds: (A:) Virus Matrix Protein

SCOPe Domain Sequences for d6ccja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ccja1 a.61.1.4 (A:2-87) automated matches {Rous sarcoma virus (strain prague c) [TaxId: 11888]}
eavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsqr
amilgksgelktwglvlgalkaaree

SCOPe Domain Coordinates for d6ccja1:

Click to download the PDB-style file with coordinates for d6ccja1.
(The format of our PDB-style files is described here.)

Timeline for d6ccja1:

  • d6ccja1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25

View in 3D
Domains from same chain:
(mouse over for more information)
d6ccja2