SCOPe 2.08: Domain d6ccja1: 6ccj A:2-87

Lineage for d6ccja1 (6ccj A:2-87)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.4: GAG polyprotein M-domain [47848] (2 proteins)
   the C-terminal helix region is missing(?)
   automatically mapped to Pfam PF02813

6. Protein automated matches [336961] (2 species)
   not a true protein

7. Species Rous sarcoma virus (strain prague c) [TaxId:11888] [336962] (3 PDB entries)

8. Domain d6ccja1: 6ccj A:2-87 [359182]
   Other proteins in same PDB: d6ccja2
   automated match to d1a6sa_

Details for d6ccja1

PDB Entry: 6ccj

PDB Description: nmr structure of the rous sarcoma virus matrix protein (m domain)

PDB Compounds: (A:) Virus Matrix Protein

SCOPe Domain Sequences for d6ccja1:

Sequence; same for both SEQRES and ATOM records:

>d6ccja1 a.61.1.4 (A:2-87) automated matches {Rous sarcoma virus (strain prague c) [TaxId: 11888]}
eavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsqr
amilgksgelktwglvlgalkaaree

Timeline for d6ccja1:

• d6ccja1 first appeared in SCOPe 2.07