Lineage for d6bb2c2 (6bb2 C:160-329)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2556804Protein Lactate dehydrogenase [56339] (20 species)
  7. 2556875Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (29 PDB entries)
  8. 3059117Domain d6bb2c2: 6bb2 C:160-329 [359179]
    Other proteins in same PDB: d6bb2a1, d6bb2b1, d6bb2c1, d6bb2d1, d6bb2e1, d6bb2f1, d6bb2g1, d6bb2h1
    automated match to d1i10d2
    complexed with d4j, lac, nad, so4

Details for d6bb2c2

PDB Entry: 6bb2 (more details), 2.47 Å

PDB Description: lactate dehydrogenase in complex with inhibitor (s)-5-((2- chlorophenyl)thio)-6'-(4-fluorophenoxy)-4-hydroxy-2-(thiophen-3-yl)- 2,3-dihydro-[2,2'-bipyridin]-6(1h)-one
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6bb2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bb2c2 d.162.1.1 (C:160-329) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkel

SCOPe Domain Coordinates for d6bb2c2:

Click to download the PDB-style file with coordinates for d6bb2c2.
(The format of our PDB-style files is described here.)

Timeline for d6bb2c2:

  • d6bb2c2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25