SCOPe 2.07: Domain d1dlua2: 1dlu A:269-392

Lineage for d1dlua2 (1dlu A:269-392)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.1: Thiolase-related [53902] (10 proteins)
Protein Biosynthetic thiolase [53905] (1 species)
Species Zoogloea ramigera [TaxId:350] [53906] (16 PDB entries)
Uniprot P07097
Domain d1dlua2: 1dlu A:269-392 [35917]
complexed with mpd, so4

Details for d1dlua2

PDB Entry: 1dlu (more details), 2.25 Å

PDB Description: unliganded biosynthetic thiolase from zoogloea ramigera

PDB Compounds: (A:) biosynthetic thiolase

SCOPe Domain Sequences for d1dlua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlua2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOPe Domain Coordinates for d1dlua2:

Click to download the PDB-style file with coordinates for d1dlua2.
(The format of our PDB-style files is described here.)

Timeline for d1dlua2: