Lineage for d6bvib1 (6bvi B:566-1046)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332645Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 2332646Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 2332647Family a.117.1.1: Ras GEF [48367] (2 proteins)
  6. 2332648Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 2332649Species Human (Homo sapiens) [TaxId:9606] [48369] (30 PDB entries)
    Uniprot Q07889 189-1046
  8. 3059100Domain d6bvib1: 6bvi B:566-1046 [359162]
    Other proteins in same PDB: d6bvia_, d6bvib2, d6bvic1, d6bvic2
    automated match to d1nvus_
    complexed with ec4, fmt, gnp, gol, mg, na

Details for d6bvib1

PDB Entry: 6bvi (more details), 1.75 Å

PDB Description: ras:sos:ras in complex with a small molecule activator
PDB Compounds: (B:) Son of sevenless homolog 1

SCOPe Domain Sequences for d6bvib1:

Sequence, based on SEQRES records: (download)

>d6bvib1 a.117.1.1 (B:566-1046) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
r

Sequence, based on observed residues (ATOM records): (download)

>d6bvib1 a.117.1.1 (B:566-1046) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkianitfqssp
ptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeins
pnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsam
nsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnil
kteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmg
nsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOPe Domain Coordinates for d6bvib1:

Click to download the PDB-style file with coordinates for d6bvib1.
(The format of our PDB-style files is described here.)

Timeline for d6bvib1:

  • d6bvib1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25