SCOPe 2.08: Domain d6a4ra1: 6a4r A:2-229

Lineage for d6a4ra1 (6a4r A:2-229)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.4: Aspartyl dipeptidase PepE [52331] (2 proteins)
   probable circular permutation in the common core; contains a catalytic Ser-His-Glu triad

6. Protein automated matches [359144] (1 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [359145] (2 PDB entries)

8. Domain d6a4ra1: 6a4r A:2-229 [359146]
   Other proteins in same PDB: d6a4ra2, d6a4rb2
   automated match to d1fyea_
   complexed with asp

Details for d6a4ra1

PDB Entry: 6a4r, 1.83 Å

PDB Description: crystal structure of aspartate bound peptidase e from salmonella enterica

PDB Compounds: (A:) Peptidase E

SCOPe Domain Sequences for d6a4ra1:

Sequence; same for both SEQRES and ATOM records:

>d6a4ra1 c.23.16.4 (A:2-229) automated matches {Salmonella typhimurium [TaxId: 99287]}
ellllsnstlpgkawlehalplianqlngrrsavfipfagvtqtwdeytdktaevlaplg
vnvtgihrvadplaaiekaeiiivgggntfqllkesrergllapmadrvkrgalyigwsa
ganlacptirttndmpivdpngfdaldlfplqinphftnalpeghkgetreqrirellvv
apeltviglpegnwiqvsngqavlggpnttwvfkageeavaleaghrf

Timeline for d6a4ra1:

• d6a4ra1 first appeared in SCOPe 2.07