Lineage for d6bvkb1 (6bvk B:566-1046)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332645Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 2332646Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 2332647Family a.117.1.1: Ras GEF [48367] (2 proteins)
  6. 2332648Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 2332649Species Human (Homo sapiens) [TaxId:9606] [48369] (30 PDB entries)
    Uniprot Q07889 189-1046
  8. 3059080Domain d6bvkb1: 6bvk B:566-1046 [359142]
    Other proteins in same PDB: d6bvka_, d6bvkb2, d6bvkc1, d6bvkc2
    automated match to d1nvus_
    complexed with eav, fmt, gnp, gol, mg, na

Details for d6bvkb1

PDB Entry: 6bvk (more details), 1.8 Å

PDB Description: ras:sos:ras in complex with a small molecule activator
PDB Compounds: (B:) Son of sevenless homolog 1

SCOPe Domain Sequences for d6bvkb1:

Sequence, based on SEQRES records: (download)

>d6bvkb1 a.117.1.1 (B:566-1046) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
r

Sequence, based on observed residues (ATOM records): (download)

>d6bvkb1 a.117.1.1 (B:566-1046) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkianitfqssp
ptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeins
pnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsam
nsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnil
kteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmg
nsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOPe Domain Coordinates for d6bvkb1:

Click to download the PDB-style file with coordinates for d6bvkb1.
(The format of our PDB-style files is described here.)

Timeline for d6bvkb1:

  • d6bvkb1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25