Lineage for d6bb1c1 (6bb1 C:2-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844354Protein Lactate dehydrogenase [51859] (19 species)
  7. 2844420Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (39 PDB entries)
  8. 2844535Domain d6bb1c1: 6bb1 C:2-159 [359128]
    Other proteins in same PDB: d6bb1a2, d6bb1b2, d6bb1c2, d6bb1d2, d6bb1e2, d6bb1f2, d6bb1g2, d6bb1h2
    automated match to d1i10d1
    complexed with d3j, lac, nad, so4

Details for d6bb1c1

PDB Entry: 6bb1 (more details), 2.3 Å

PDB Description: lactate dehydrogenase in complex with inhibitor (r)-5-((2- chlorophenyl)thio)-6'-(4-fluorophenoxy)-4-hydroxy-2-(thiophen-3-yl)- 2,3-dihydro-[2,2'-bipyridin]-6(1h)-one
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6bb1c1:

Sequence, based on SEQRES records: (download)

>d6bb1c1 c.2.1.5 (C:2-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
tlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgem
mdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiip
nvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records): (download)

>d6bb1c1 c.2.1.5 (C:2-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
tlkdqliynllkqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmd
lqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipnv
vkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d6bb1c1:

Click to download the PDB-style file with coordinates for d6bb1c1.
(The format of our PDB-style files is described here.)

Timeline for d6bb1c1: