Lineage for d6a7pb3 (6a7p B:389-568)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336647Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2336648Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2336649Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2336650Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2336651Species Human (Homo sapiens) [TaxId:9606] [48555] (82 PDB entries)
    Uniprot P02768 29-596
  8. 3059057Domain d6a7pb3: 6a7p B:389-568 [359119]
    automated match to d1n5ua3
    complexed with 9sc, k, pg4, po4

Details for d6a7pb3

PDB Entry: 6a7p (more details), 2.28 Å

PDB Description: human serum albumin complexed with aripiprazole
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d6a7pb3:

Sequence, based on SEQRES records: (download)

>d6a7pb3 a.126.1.1 (B:389-568) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf

Sequence, based on observed residues (ATOM records): (download)

>d6a7pb3 a.126.1.1 (B:389-568) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddkcf

SCOPe Domain Coordinates for d6a7pb3:

Click to download the PDB-style file with coordinates for d6a7pb3.
(The format of our PDB-style files is described here.)

Timeline for d6a7pb3:

  • d6a7pb3 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25