Lineage for d6baxc1 (6bax C:1-159)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2429095Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2429134Protein Lactate dehydrogenase [51859] (19 species)
  7. 2429200Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (29 PDB entries)
  8. 3059049Domain d6baxc1: 6bax C:1-159 [359111]
    Other proteins in same PDB: d6baxa2, d6baxb2, d6baxc2, d6baxd2
    automated match to d1i10d1
    complexed with d4s, epe, nad, so4

Details for d6baxc1

PDB Entry: 6bax (more details), 2.05 Å

PDB Description: lactate dehydrogenase in complex with inhibitor 6-(3-aminophenyl)-3- ((2-chlorophenyl)thio)-4-hydroxy-6-(thiophen-3-yl)-5,6-dihydro-2h- pyran-2-one
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6baxc1:

Sequence, based on SEQRES records: (download)

>d6baxc1 c.2.1.5 (C:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records): (download)

>d6baxc1 c.2.1.5 (C:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagasrlnlvqrnvnifkfiipnvvky
spnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d6baxc1:

Click to download the PDB-style file with coordinates for d6baxc1.
(The format of our PDB-style files is described here.)

Timeline for d6baxc1:

  • d6baxc1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25