Lineage for d6bu0b1 (6bu0 B:1559-1683)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2368400Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2368401Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2368651Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2368652Protein automated matches [190497] (4 species)
    not a true protein
  7. 2368655Species Human (Homo sapiens) [TaxId:9606] [188711] (25 PDB entries)
  8. 3059037Domain d6bu0b1: 6bu0 B:1559-1683 [359099]
    Other proteins in same PDB: d6bu0b2, d6bu0c2
    automated match to d1rh8a_
    complexed with fmt, ihp, o4b

Details for d6bu0b1

PDB Entry: 6bu0 (more details), 2.43 Å

PDB Description: crystal structure of the pi3kc2alpha c2 domain in complex with ip6
PDB Compounds: (B:) Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha

SCOPe Domain Sequences for d6bu0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bu0b1 b.7.1.0 (B:1559-1683) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iggavklsisyrngtlfimvmhikdlvtedgadpnpyvktyllpdnhktskrktkisrkt
rnptfnemlvysgysketlrqrelqlsvlsaeslrgnfflggvtlplkdfnlsketvkwy
qltaa

SCOPe Domain Coordinates for d6bu0b1:

Click to download the PDB-style file with coordinates for d6bu0b1.
(The format of our PDB-style files is described here.)

Timeline for d6bu0b1:

  • d6bu0b1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18