Lineage for d6hrla_ (6hrl A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2399047Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2399091Family b.68.11.0: automated matches [191536] (1 protein)
    not a true family
  6. 2399092Protein automated matches [190912] (2 species)
    not a true protein
  7. 2399093Species Human (Homo sapiens) [TaxId:9606] [188385] (5 PDB entries)
  8. 3059035Domain d6hrla_: 6hrl A: [359097]
    automated match to d2xn4a_
    complexed with cl, edo, na, so4

Details for d6hrla_

PDB Entry: 6hrl (more details), 2.6 Å

PDB Description: crystal structure of the kelch domain of human klhl17
PDB Compounds: (A:) Kelch-like protein 17

SCOPe Domain Sequences for d6hrla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hrla_ b.68.11.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gagpvlfavgggslfaihgdceaydtrtdrwhvvasmstrrarvgvaavgnrlyavggyd
gtsdlatvesydpvtntwqpevsmgtrrsclgvaalhgllysaggydgasclnsaerydp
ltgtwtsvaamstrrryvrvatldgnlyavggydssshlatvekyepqvnvwspvasmls
rrssagvavlegalyvaggndgtsclnsveryspkagawesvapmnirrsthdlvamdgw
lyavggndgssslnsiekynprtnkwvaascmftrrssvgvavlell

SCOPe Domain Coordinates for d6hrla_:

Click to download the PDB-style file with coordinates for d6hrla_.
(The format of our PDB-style files is described here.)

Timeline for d6hrla_:

  • d6hrla_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18