Lineage for d5ys1a1 (5ys1 A:30-170)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367152Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2367277Protein multi-copper oxidase CueO [69194] (1 species)
  7. 2367278Species Escherichia coli [TaxId:562] [69195] (36 PDB entries)
  8. 3059030Domain d5ys1a1: 5ys1 A:30-170 [359092]
    automated match to d1kv7a1
    complexed with cu; mutant

Details for d5ys1a1

PDB Entry: 5ys1 (more details), 1.49 Å

PDB Description: crystal structure of multicopper oxidase cueo g304k mutant
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d5ys1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ys1a1 b.6.1.3 (A:30-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
erptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvd
iynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktg
rqvamglaglvvieddeilkl

SCOPe Domain Coordinates for d5ys1a1:

Click to download the PDB-style file with coordinates for d5ys1a1.
(The format of our PDB-style files is described here.)

Timeline for d5ys1a1:

  • d5ys1a1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18