Lineage for d6mn8a2 (6mn8 A:328-461)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459598Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2459599Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2459718Family c.51.1.0: automated matches [227929] (1 protein)
    not a true family
  6. 2459719Protein automated matches [227930] (4 species)
    not a true protein
  7. 3059026Species Onchocerca volvulus [TaxId:6282] [359088] (1 PDB entry)
  8. 3059027Domain d6mn8a2: 6mn8 A:328-461 [359089]
    Other proteins in same PDB: d6mn8a1, d6mn8a3
    automated match to d1hc7a1
    complexed with 2pn, amp, anp, gly, hfg, mg, ser

Details for d6mn8a2

PDB Entry: 6mn8 (more details), 2.35 Å

PDB Description: crystal structure of prolyl-trna synthetase from onchocerca volvulus with bound halofuginone and nucleotide
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d6mn8a2:

Sequence, based on SEQRES records: (download)

>d6mn8a2 c.51.1.0 (A:328-461) automated matches {Onchocerca volvulus [TaxId: 6282]}
cglvlpprvatiqmiivpvginaqtkdeqktaliekakeinnklmdasiraeldirdhis
pgwkfnhwelkgvpvrieigpkdlannqvtcvirysgekrtipidglaskckdmleeihy
smynrilevresht

Sequence, based on observed residues (ATOM records): (download)

>d6mn8a2 c.51.1.0 (A:328-461) automated matches {Onchocerca volvulus [TaxId: 6282]}
cglvlpprvatiqmiivpvgitkdeqktaliekakeinnklmdasiraeldirdhispgw
kfnhwelkgvpvrieigpkdlannqvtcvirysgekrtipidglaskckdmleeihysmy
nrilevresht

SCOPe Domain Coordinates for d6mn8a2:

Click to download the PDB-style file with coordinates for d6mn8a2.
(The format of our PDB-style files is described here.)

Timeline for d6mn8a2:

  • d6mn8a2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18