Lineage for d6mn8a1 (6mn8 A:54-327)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532945Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2532946Protein automated matches [226887] (15 species)
    not a true protein
  7. 3059024Species Onchocerca volvulus [TaxId:6282] [359086] (1 PDB entry)
  8. 3059025Domain d6mn8a1: 6mn8 A:54-327 [359087]
    Other proteins in same PDB: d6mn8a2, d6mn8a3
    automated match to d1hc7a2
    complexed with 2pn, amp, anp, gly, hfg, mg, ser

Details for d6mn8a1

PDB Entry: 6mn8 (more details), 2.35 Å

PDB Description: crystal structure of prolyl-trna synthetase from onchocerca volvulus with bound halofuginone and nucleotide
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d6mn8a1:

Sequence, based on SEQRES records: (download)

>d6mn8a1 d.104.1.0 (A:54-327) automated matches {Onchocerca volvulus [TaxId: 6282]}
ieiskdenysewyvqvitkaemieyydisgcyvlrpwsyaiwefiqewfdeeikklgvkn
cyfplfvsqsalekekthisdfapevawitragqsdlaeaiairptsetvmypsyakwvq
shrdlpiklnqwcnvvrwefkhptpflrtreflwqeghtafqskdeaedevfkildlyaq
iyidllaipvikgrktekenfaggdftatveayvpvngrgiqgatshhlgqnfskmfnis
fedpngggkiyawqnswgistrtigalvmihgdn

Sequence, based on observed residues (ATOM records): (download)

>d6mn8a1 d.104.1.0 (A:54-327) automated matches {Onchocerca volvulus [TaxId: 6282]}
ieiskdenysewyvqvitkaemieyydisgcyvlrpwsyaiwefiqewfdeeikklgvkn
cyfplfvsqsalekefapevawitragqsdlaeaiairptsetvmypsyakwvqshrdlp
iklnqwcnvvrwefkhptpflrtreflwqeghtafqskdeaedevfkildlyaqiyidll
aipvikgrkggdftatveayvpvngrgiqgatshhlgqnfskmfnisfedpngggkiyaw
qnswgistrtigalvmihgdn

SCOPe Domain Coordinates for d6mn8a1:

Click to download the PDB-style file with coordinates for d6mn8a1.
(The format of our PDB-style files is described here.)

Timeline for d6mn8a1:

  • d6mn8a1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18