Lineage for d1qfla1 (1qfl A:4-268)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2164459Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2164705Protein Biosynthetic thiolase [53905] (1 species)
  7. 2164706Species Zoogloea ramigera [TaxId:350] [53906] (16 PDB entries)
    Uniprot P07097
  8. 2164779Domain d1qfla1: 1qfl A:4-268 [35908]
    complexed with coa, so4

Details for d1qfla1

PDB Entry: 1qfl (more details), 1.92 Å

PDB Description: biosynthetic thiolase from zoogloea ramigera in complex with a reaction intermediate.
PDB Compounds: (A:) protein (acetoacetyl-coa thiolase)

SCOPe Domain Sequences for d1qfla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfla1 c.95.1.1 (A:4-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
gnasglndgaaaallmseaeasrrg

SCOPe Domain Coordinates for d1qfla1:

Click to download the PDB-style file with coordinates for d1qfla1.
(The format of our PDB-style files is described here.)

Timeline for d1qfla1: