SCOP 1.59: Domain d1pxtb2: 1pxt B:294-417

Lineage for d1pxtb2 (1pxt B:294-417)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)

6. Protein Thiolase [53903] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries)

8. Domain d1pxtb2: 1pxt B:294-417 [35907]

Details for d1pxtb2

PDB Entry: 1pxt, 2.8 Å

PDB Description: the 2.8 angstroms structure of peroxisomal 3-ketoacyl-coa thiolase of saccharomyces cerevisiae: a five layered a-b-a-b-a structure, constructed from two core domains of identical topology

SCOP Domain Sequences for d1pxtb2:

Sequence; same for both SEQRES and ATOM records:

>d1pxtb2 c.95.1.1 (B:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae)}
lnlpvlgryidfqtvgvppeimgvgpayaipkvleatglqvqdidifeineafaaqalyc
ihklgidlnkvnprggaialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaai
fike

Timeline for d1pxtb2:

• d1pxtb2 first appeared (with stable ids) in SCOP 1.55
  
• d1pxtb2 appears in SCOP 1.57
  
• d1pxtb2 appears in SCOP 1.61
  
• d1pxtb2 appears in the current release, SCOPe 2.08