Lineage for d1pxtb2 (1pxt B:294-417)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128395Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 128396Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 128397Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 128514Protein Thiolase [53903] (1 species)
  7. 128515Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries)
  8. 128523Domain d1pxtb2: 1pxt B:294-417 [35907]

Details for d1pxtb2

PDB Entry: 1pxt (more details), 2.8 Å

PDB Description: the 2.8 angstroms structure of peroxisomal 3-ketoacyl-coa thiolase of saccharomyces cerevisiae: a five layered a-b-a-b-a structure, constructed from two core domains of identical topology

SCOP Domain Sequences for d1pxtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxtb2 c.95.1.1 (B:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae)}
lnlpvlgryidfqtvgvppeimgvgpayaipkvleatglqvqdidifeineafaaqalyc
ihklgidlnkvnprggaialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaai
fike

SCOP Domain Coordinates for d1pxtb2:

Click to download the PDB-style file with coordinates for d1pxtb2.
(The format of our PDB-style files is described here.)

Timeline for d1pxtb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pxtb1