![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) |
![]() | Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (5 proteins) |
![]() | Protein Thiolase [53903] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries) |
![]() | Domain d1pxtb2: 1pxt B:294-417 [35907] |
PDB Entry: 1pxt (more details), 2.8 Å
SCOP Domain Sequences for d1pxtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pxtb2 c.95.1.1 (B:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae)} lnlpvlgryidfqtvgvppeimgvgpayaipkvleatglqvqdidifeineafaaqalyc ihklgidlnkvnprggaialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaai fike
Timeline for d1pxtb2: