Lineage for d5zoka1 (5zok A:266-462)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372848Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2372849Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2372984Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2372985Protein automated matches [191125] (7 species)
    not a true protein
  7. 2372996Species Human (Homo sapiens) [TaxId:9606] [189203] (4 PDB entries)
  8. 3059007Domain d5zoka1: 5zok A:266-462 [359069]
    Other proteins in same PDB: d5zoka2, d5zokc2
    automated match to d3gmja_
    protein/DNA complex

Details for d5zoka1

PDB Entry: 5zok (more details), 2.85 Å

PDB Description: crystal structure of human smad1-man1 complex.
PDB Compounds: (A:) Mothers against decapentaplegic homolog 1

SCOPe Domain Sequences for d5zoka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zoka1 b.26.1.0 (A:266-462) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eepkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstien
trrhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnn
qefaqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplq
wldkvltqmgsphnpis

SCOPe Domain Coordinates for d5zoka1:

Click to download the PDB-style file with coordinates for d5zoka1.
(The format of our PDB-style files is described here.)

Timeline for d5zoka1:

  • d5zoka1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18

View in 3D
Domains from same chain:
(mouse over for more information)
d5zoka2