Lineage for d5ykca1 (5ykc A:2-325)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (36 species)
    not a true protein
  7. 3058989Species Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId:1490024] [359051] (1 PDB entry)
  8. 3059000Domain d5ykca1: 5ykc A:2-325 [359062]
    Other proteins in same PDB: d5ykca2, d5ykcb2, d5ykcc2
    automated match to d4we4a_
    complexed with nag

Details for d5ykca1

PDB Entry: 5ykc (more details), 2.82 Å

PDB Description: crystal structure of h5 hemagglutinin from a/chicken/taiwan/0502/2012
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5ykca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ykca1 b.19.1.0 (A:2-325) automated matches {Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId: 1490024]}
agdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsva
gwllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifp
rsswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgi
hhpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvngqsgrmeffwtilrpnds
itfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfa
igecpkyvklkklvlatglrnipq

SCOPe Domain Coordinates for d5ykca1:

Click to download the PDB-style file with coordinates for d5ykca1.
(The format of our PDB-style files is described here.)

Timeline for d5ykca1:

  • d5ykca1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18