Lineage for d5ykcb2 (5ykc B:335-503)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041844Species Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId:1490024] [359053] (4 PDB entries)
  8. 3041849Domain d5ykcb2: 5ykc B:335-503 [359061]
    Other proteins in same PDB: d5ykca1, d5ykca3, d5ykcb1, d5ykcb3, d5ykcc1, d5ykcc3
    automated match to d1ha0a2
    complexed with nag

Details for d5ykcb2

PDB Entry: 5ykc (more details), 2.82 Å

PDB Description: crystal structure of h5 hemagglutinin from a/chicken/taiwan/0502/2012
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5ykcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ykcb2 h.3.1.0 (B:335-503) automated matches {Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId: 1490024]}
iagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvnsiiskmnsqfea
vgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhdsnvknlydkvrrq
lrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreeid

SCOPe Domain Coordinates for d5ykcb2:

Click to download the PDB-style file with coordinates for d5ykcb2.
(The format of our PDB-style files is described here.)

Timeline for d5ykcb2: