Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId:1490024] [359053] (4 PDB entries) |
Domain d5ykcb2: 5ykc B:335-503 [359061] Other proteins in same PDB: d5ykca1, d5ykca3, d5ykcb1, d5ykcb3, d5ykcc1, d5ykcc3 automated match to d1ha0a2 complexed with nag |
PDB Entry: 5ykc (more details), 2.82 Å
SCOPe Domain Sequences for d5ykcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ykcb2 h.3.1.0 (B:335-503) automated matches {Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId: 1490024]} iagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvnsiiskmnsqfea vgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhdsnvknlydkvrrq lrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreeid
Timeline for d5ykcb2: