Lineage for d5ykcc2 (5ykc C:335-505)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (24 species)
    not a true protein
  7. 3058991Species Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId:1490024] [359053] (1 PDB entry)
  8. 3058992Domain d5ykcc2: 5ykc C:335-505 [359054]
    Other proteins in same PDB: d5ykca1, d5ykcb1, d5ykcc1
    automated match to d1ha0a2
    complexed with nag

Details for d5ykcc2

PDB Entry: 5ykc (more details), 2.82 Å

PDB Description: crystal structure of h5 hemagglutinin from a/chicken/taiwan/0502/2012
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d5ykcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ykcc2 h.3.1.0 (C:335-505) automated matches {Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId: 1490024]}
iagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvnsiiskmnsqfea
vgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhdsnvknlydkvrrq
lrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreeidsg

SCOPe Domain Coordinates for d5ykcc2:

Click to download the PDB-style file with coordinates for d5ykcc2.
(The format of our PDB-style files is described here.)

Timeline for d5ykcc2:

  • d5ykcc2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18