Lineage for d6ml8b_ (6ml8 B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 3058978Species Influenza a virus (a/denver/1957(h1n1)) [TaxId:385583] [359040] (1 PDB entry)
  8. 3058979Domain d6ml8b_: 6ml8 B: [359041]
    Other proteins in same PDB: d6ml8a_, d6ml8l1, d6ml8l2
    automated match to d5ugyb_
    complexed with bma, man, nag

Details for d6ml8b_

PDB Entry: 6ml8 (more details), 2.92 Å

PDB Description: crystal structure of hemagglutinin from h1n1 influenza a virus a/denver/57 bound to the c05 antibody
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6ml8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ml8b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza a virus (a/denver/1957(h1n1)) [TaxId: 385583]}
fgaiagfieggwtgmmdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmntq
ftavgkefnklekrmenlnkkvddgfmdiwtynaellvllenertldfhdsnvknlyekv
knqlrnnakelgngcfefyhkcdnecmesvkngtydy

SCOPe Domain Coordinates for d6ml8b_:

Click to download the PDB-style file with coordinates for d6ml8b_.
(The format of our PDB-style files is described here.)

Timeline for d6ml8b_:

  • d6ml8b_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18