Lineage for d6mlkl1 (6mlk L:16-128)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1083 PDB entries)
  8. 3058969Domain d6mlkl1: 6mlk L:16-128 [359031]
    Other proteins in same PDB: d6mlka_, d6mlkl2
    automated match to d1um5l1
    complexed with cl

Details for d6mlkl1

PDB Entry: 6mlk (more details), 2.45 Å

PDB Description: structure of thioesterase from debs with a thioesterase-specific antibody
PDB Compounds: (L:) Light chain of Fab 3A6

SCOPe Domain Sequences for d6mlkl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mlkl1 b.1.1.0 (L:16-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldvvmtqsplslpvtpgepasiscrssqsllhsngynyldwylqkpgqspqlliylgsnr
asgvpdrfsgsgsgtdftlkisrveaedvgvyycmqgthwprtfgqgtkveik

SCOPe Domain Coordinates for d6mlkl1:

Click to download the PDB-style file with coordinates for d6mlkl1.
(The format of our PDB-style files is described here.)

Timeline for d6mlkl1:

  • d6mlkl1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18

View in 3D
Domains from same chain:
(mouse over for more information)
d6mlkl2
View in 3D
Domains from other chains:
(mouse over for more information)
d6mlka_