Lineage for d6ml8a_ (6ml8 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2370862Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2371293Protein automated matches [190291] (18 species)
    not a true protein
  7. 2371399Species Influenza A virus [TaxId:641501] [256167] (2 PDB entries)
  8. 3058965Domain d6ml8a_: 6ml8 A: [359027]
    Other proteins in same PDB: d6ml8b_, d6ml8l1, d6ml8l2
    automated match to d3ztna_
    complexed with bma, man, nag

Details for d6ml8a_

PDB Entry: 6ml8 (more details), 2.92 Å

PDB Description: crystal structure of hemagglutinin from h1n1 influenza a virus a/denver/57 bound to the c05 antibody
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6ml8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ml8a_ b.19.1.2 (A:) automated matches {Influenza A virus [TaxId: 641501]}
ticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgkaplqlgncniagwv
lgnpecesllsnrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpker
swpnhttrgvtaacpharkssfyknlvwlteangsypnlsrsyvnnqekevlvlwgvhhp
snieeqralyrkdnayvsvvssnynrrftpeiakrpkvrdqsgrmnyywtllepgdtiif
eatgnliapwyafalsrgpgsgiitsnapldecdtkcqtpqgainsslpfqnihpvtige
cpkyvrstklrmvtglrnips

SCOPe Domain Coordinates for d6ml8a_:

Click to download the PDB-style file with coordinates for d6ml8a_.
(The format of our PDB-style files is described here.)

Timeline for d6ml8a_:

  • d6ml8a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18