Lineage for d6mlka_ (6mlk A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2475910Family c.69.1.22: Thioesterase domain of polypeptide, polyketide and fatty acid synthases [69584] (4 proteins)
    Pfam PF00975
  6. 2475911Protein Erythromycin polyketide synthase [69585] (1 species)
    synonym: 6-deoxyerythronolide synthase
  7. 2475912Species Saccharopolyspora erythraea [TaxId:1836] [69586] (5 PDB entries)
  8. 3058960Domain d6mlka_: 6mlk A: [359022]
    Other proteins in same PDB: d6mlkl1, d6mlkl2
    automated match to d1keza_
    complexed with cl

Details for d6mlka_

PDB Entry: 6mlk (more details), 2.45 Å

PDB Description: structure of thioesterase from debs with a thioesterase-specific antibody
PDB Compounds: (A:) 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6

SCOPe Domain Sequences for d6mlka_:

Sequence, based on SEQRES records: (download)

>d6mlka_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}
salrdgyrqagvsgrvrsyldllaglsdfrehfdgsdgfsldlvdmadgpgevtviccag
taaisgpheftrlagalrgiapvravpqpgyeegeplpssmaavaavqadavirtqgdkp
fvvaghsagalmayalatelldrghpprgvvlidvyppghqdamnawleeltatlfdret
vrmddtrltalgaydrltgqwrpretglptllvsagepmgpwpddswkptwpfehdtvav
pgdhftmvqehadaiarhidawlg

Sequence, based on observed residues (ATOM records): (download)

>d6mlka_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}
salrdgyrqagvsgrvrsyldllaglsdfrehfdgfsldlvdmgpgevtviccagtaais
gpheftrlagalrgiapvravpqpgyeegeplpssmaavaavqadavirtqkpfvvaghs
agalmayalatelldrghpprgvvlidvyppghqdamnawleeltatlfdretvrmddtr
ltalgaydrltgqwrpretglptllvsagepmgpwpddswkptwpfehdtvavpgdhftm
vqehadaiarhidawlg

SCOPe Domain Coordinates for d6mlka_:

Click to download the PDB-style file with coordinates for d6mlka_.
(The format of our PDB-style files is described here.)

Timeline for d6mlka_:

  • d6mlka_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18