SCOP 1.57: Domain d1afwb1: 1afw B:25-293

Lineage for d1afwb1 (1afw B:25-293)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)

6. Protein Thiolase [53903] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries)

8. Domain d1afwb1: 1afw B:25-293 [35902]

Details for d1afwb1

PDB Entry: 1afw, 1.8 Å

PDB Description: the 1.8 angstrom crystal structure of the dimeric peroxisomal thiolase of saccharomyces cerevisiae

SCOP Domain Sequences for d1afwb1:

Sequence; same for both SEQRES and ATOM records:

>d1afwb1 c.95.1.1 (B:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae)}
knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl
ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi
diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq
defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikd
rgtttagnasqvsdgvagvllarrsvanq

Timeline for d1afwb1:

• d1afwb1 first appeared (with stable ids) in SCOP 1.55
  
• d1afwb1 appears in SCOP 1.59
  
• d1afwb1 appears in the current release, SCOPe 2.08