Lineage for d6c40d_ (6c40 D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438296Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2438577Protein automated matches [190177] (8 species)
    not a true protein
  7. 3058792Species Thermotoga maritima [TaxId:243274] [358854] (1 PDB entry)
  8. 3058957Domain d6c40d_: 6c40 D: [359019]
    automated match to d1u0sy_
    complexed with cu

Details for d6c40d_

PDB Entry: 6c40 (more details), 2.7 Å

PDB Description: chey41pytyrd54k from thermotoga maritima
PDB Compounds: (D:) Chemotaxis protein cheY

SCOPe Domain Sequences for d6c40d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c40d_ c.23.1.1 (D:) automated matches {Thermotoga maritima [TaxId: 243274]}
gkrvlivddaafmrmmlkdiitkagyevageatngreavxkykelkpdivtmkitmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs

SCOPe Domain Coordinates for d6c40d_:

Click to download the PDB-style file with coordinates for d6c40d_.
(The format of our PDB-style files is described here.)

Timeline for d6c40d_:

  • d6c40d_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18