Lineage for d6h7nd1 (6h7n D:6-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744050Domain d6h7nd1: 6h7n D:6-120 [359017]
    Other proteins in same PDB: d6h7nc2, d6h7nd2, d6h7ne1, d6h7ne2, d6h7nf_
    automated match to d5da4a_
    complexed with 2cv, fvk, na

Details for d6h7nd1

PDB Entry: 6h7n (more details), 2.5 Å

PDB Description: activated turkey beta1 adrenoceptor with bound partial agonist xamoterol and nanobody nb6b9
PDB Compounds: (D:) Camelid antibody fragment Nb6B9

SCOPe Domain Sequences for d6h7nd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h7nd1 b.1.1.1 (D:6-120) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgsifalnimgwyrqapgkqrelvaaihsggttnyansvkg
rftisrdnaantvylqmnslkpedtavyycnvkdfgaiiydydywgqgtqvtvss

SCOPe Domain Coordinates for d6h7nd1:

Click to download the PDB-style file with coordinates for d6h7nd1.
(The format of our PDB-style files is described here.)

Timeline for d6h7nd1:

  • d6h7nd1 first appeared in SCOPe 2.07, called d6h7nd_