Lineage for d6h7nd_ (6h7n D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (155 PDB entries)
  8. 3058955Domain d6h7nd_: 6h7n D: [359017]
    Other proteins in same PDB: d6h7nc2, d6h7ne1, d6h7ne2, d6h7nf_
    automated match to d5da4a_
    complexed with 2cv, fvk, na

Details for d6h7nd_

PDB Entry: 6h7n (more details), 2.5 Å

PDB Description: activated turkey beta1 adrenoceptor with bound partial agonist xamoterol and nanobody nb6b9
PDB Compounds: (D:) Camelid antibody fragment Nb6B9

SCOPe Domain Sequences for d6h7nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h7nd_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
sqvqlqesggglvqaggslrlscaasgsifalnimgwyrqapgkqrelvaaihsggttny
ansvkgrftisrdnaantvylqmnslkpedtavyycnvkdfgaiiydydywgqgtqvtvs
s

SCOPe Domain Coordinates for d6h7nd_:

Click to download the PDB-style file with coordinates for d6h7nd_.
(The format of our PDB-style files is described here.)

Timeline for d6h7nd_:

  • d6h7nd_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18