SCOPe 2.08: Domain d6fy1l1: 6fy1 L:2-107

Lineage for d6fy1l1 (6fy1 L:2-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6fy1l1: 6fy1 L:2-107 [359003]
   Other proteins in same PDB: d6fy1l2
   automated match to d1lila1

Details for d6fy1l1

PDB Entry: 6fy1, 3.13 Å

PDB Description: crystal structure of a v2p-reactive rv144 vaccine-like antibody, cap228-16h, in complex with a scaffolded autologous v1v2

PDB Compounds: (L:) CAP228-16H Light Chain

SCOPe Domain Sequences for d6fy1l1:

Sequence; same for both SEQRES and ATOM records:

>d6fy1l1 b.1.1.0 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvapgttatitcggvdigstlvhwyqqrpgqapllviyddsdrpsgiperf
sgsnsgnmatltisrveagdeadyycqvwhstsavifgggtkltvls

Timeline for d6fy1l1:

• d6fy1l1 first appeared in SCOPe 2.07