Lineage for d6hvda1 (6hvd A:19-309)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (17 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (660 PDB entries)
  8. 3058932Domain d6hvda1: 6hvd A:19-309 [358994]
    Other proteins in same PDB: d6hvda2
    automated match to d4bc6a_
    complexed with edo, guq, so4

Details for d6hvda1

PDB Entry: 6hvd (more details), 1.63 Å

PDB Description: human slk bound to a maleimide inhibitor
PDB Compounds: (A:) ste20-like serine/threonine-protein kinase

SCOPe Domain Sequences for d6hvda1:

Sequence, based on SEQRES records: (download)

>d6hvda1 d.144.1.7 (A:19-309) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqyehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledymv
eidilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckq
tldalnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywma
pevvmcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqp
srwssnfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeaka

Sequence, based on observed residues (ATOM records): (download)

>d6hvda1 d.144.1.7 (A:19-309) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqyehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledymv
eidilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckq
tldalnylhdnkiihrdlkagnilftldgdikladfgvsakntrsfigtpywmapevvmc
etskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsrwssn
fkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeaka

SCOPe Domain Coordinates for d6hvda1:

Click to download the PDB-style file with coordinates for d6hvda1.
(The format of our PDB-style files is described here.)

Timeline for d6hvda1:

  • d6hvda1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18

View in 3D
Domains from same chain:
(mouse over for more information)
d6hvda2