Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Physcomitrella patens [TaxId:3218] [358908] (1 PDB entry) |
Domain d6dx7a1: 6dx7 A:9-240 [358992] automated match to d4yjyb1 |
PDB Entry: 6dx7 (more details), 2.61 Å
SCOPe Domain Sequences for d6dx7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dx7a1 c.95.1.0 (A:9-240) automated matches {Physcomitrella patens [TaxId: 3218]} raalpraqpraegpacvlgigtavppaeflqseypefffnitncgekealkakfkricdk sgirkrhmflteevlkanpgictymepslnvrhdivvvqvpklaaeaaqkaikewggrks dithivfattsgvnmpgadhalakllglkptvkrvmmyqtgcfggasvlrvakdlaennk garvlavasevtavtyrapsenhldglvgsalfgdgagvyvvgsdpkpevek
Timeline for d6dx7a1: