Lineage for d6gxda_ (6gxd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902904Species Rhodopseudomonas palustris [TaxId:1076] [267879] (11 PDB entries)
  8. 2902928Domain d6gxda_: 6gxd A: [358987]
    automated match to d5k3ba_
    complexed with cl, fah

Details for d6gxda_

PDB Entry: 6gxd (more details), 1.8 Å

PDB Description: the hit-and-return system enables efficient time-resolved serial synchrotron crystallography: facd752ms after reaction initiation
PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d6gxda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gxda_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
dladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviv
adlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlald
spgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakl
aswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipv
pmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

SCOPe Domain Coordinates for d6gxda_:

Click to download the PDB-style file with coordinates for d6gxda_.
(The format of our PDB-style files is described here.)

Timeline for d6gxda_: