Lineage for d6h7oe_ (6h7o E:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2455317Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2455383Protein Thioredoxin [52835] (16 species)
  7. 2455405Species Escherichia coli [TaxId:562] [52836] (53 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 3058924Domain d6h7oe_: 6h7o E: [358986]
    Other proteins in same PDB: d6h7oc1, d6h7oc2, d6h7od_
    automated match to d1f6mc_
    complexed with 2cv, na, p32

Details for d6h7oe_

PDB Entry: 6h7o (more details), 2.8 Å

PDB Description: activated turkey beta1 adrenoceptor with bound weak partial agonist cyanopindolol and nanobody nb6b9
PDB Compounds: (E:) Thioredoxin 1

SCOPe Domain Sequences for d6h7oe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h7oe_ c.47.1.1 (E:) Thioredoxin {Escherichia coli [TaxId: 562]}
dkiihltddsfdtdvlkadgailvdfwaewsgpskmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d6h7oe_:

Click to download the PDB-style file with coordinates for d6h7oe_.
(The format of our PDB-style files is described here.)

Timeline for d6h7oe_:

  • d6h7oe_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18