Lineage for d6dxbd2 (6dxb D:242-395)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2488780Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 2489053Protein automated matches [226868] (5 species)
    not a true protein
  7. 3058794Species Arabidopsis thaliana [TaxId:3702] [358856] (3 PDB entries)
  8. 3058917Domain d6dxbd2: 6dxb D:242-395 [358979]
    automated match to d1bi5a2
    complexed with csd

Details for d6dxbd2

PDB Entry: 6dxb (more details), 1.55 Å

PDB Description: crystal structure of chalcone synthase from arabidopsis thaliana
PDB Compounds: (D:) chalcone synthase

SCOPe Domain Sequences for d6dxbd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dxbd2 c.95.1.2 (D:242-395) automated matches {Arabidopsis thaliana [TaxId: 3702]}
ifemvsaaqtilpdsdgaidghlrevgltfhllkdvpglisknivksldeafkplgisdw
nslfwiahpggpaildqveiklglkeekmratrhvlseygnmssacvlfildemrrksak
dgvattgeglewgvlfgfgpgltvetvvlhsvpl

SCOPe Domain Coordinates for d6dxbd2:

Click to download the PDB-style file with coordinates for d6dxbd2.
(The format of our PDB-style files is described here.)

Timeline for d6dxbd2:

  • d6dxbd2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18