Lineage for d6gxha_ (6gxh A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (105 species)
    not a true protein
  7. 2477251Species Rhodopseudomonas palustris [TaxId:258594] [329218] (13 PDB entries)
  8. 3058909Domain d6gxha_: 6gxh A: [358971]
    automated match to d5k3ba_

Details for d6gxha_

PDB Entry: 6gxh (more details), 1.8 Å

PDB Description: the hit-and-return system enables efficient time-resolved serial synchrotron crystallography: facd 0ms after reaction initiation
PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d6gxha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gxha_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
dladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviv
adlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlald
spgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakl
aswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipv
pmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs

SCOPe Domain Coordinates for d6gxha_:

Click to download the PDB-style file with coordinates for d6gxha_.
(The format of our PDB-style files is described here.)

Timeline for d6gxha_:

  • d6gxha_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18

View in 3D
Domains from other chains:
(mouse over for more information)
d6gxhb_