Lineage for d6gj0a_ (6gj0 A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570739Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2570740Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2570741Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2570928Protein Inositol monophosphatase [56663] (1 species)
  7. 2570929Species Human (Homo sapiens) [TaxId:9606] [56664] (11 PDB entries)
  8. 3058905Domain d6gj0a_: 6gj0 A: [358967]
    automated match to d1imaa_
    complexed with gol, mes, mn

Details for d6gj0a_

PDB Entry: 6gj0 (more details), 1.73 Å

PDB Description: human impase with mn
PDB Compounds: (A:) inositol monophosphatase 1

SCOPe Domain Sequences for d6gj0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gj0a_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]}
pwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyp
shsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvy
scvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklf
cipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpf
dlmsrrviaannrilaeriakeiqviplqrdded

SCOPe Domain Coordinates for d6gj0a_:

Click to download the PDB-style file with coordinates for d6gj0a_.
(The format of our PDB-style files is described here.)

Timeline for d6gj0a_:

  • d6gj0a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18