Lineage for d6g31f_ (6g31 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337563Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 2337579Protein Geranylgeranyl pyrophosphate synthetase [158813] (1 species)
  7. 2337580Species Human (Homo sapiens) [TaxId:9606] [158814] (4 PDB entries)
    Uniprot O95749 6-296
  8. 3058896Domain d6g31f_: 6g31 F: [358958]
    automated match to d2q80a1
    complexed with mg, zol; mutant

Details for d6g31f_

PDB Entry: 6g31 (more details), 3 Å

PDB Description: crystal structure of human geranylgeranyl diphosphate synthase mutant d188y bound to zoledronate
PDB Compounds: (F:) Geranylgeranyl pyrophosphate synthase

SCOPe Domain Sequences for d6g31f_:

Sequence, based on SEQRES records: (download)

>d6g31f_ a.128.1.1 (F:) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]}
etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhqg
qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
irydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikk
ycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfk

Sequence, based on observed residues (ATOM records): (download)

>d6g31f_ a.128.1.1 (F:) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]}
etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhqg
qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
irydyanlhsksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyl
edvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfk

SCOPe Domain Coordinates for d6g31f_:

Click to download the PDB-style file with coordinates for d6g31f_.
(The format of our PDB-style files is described here.)

Timeline for d6g31f_:

  • d6g31f_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18