Lineage for d6ba1j1 (6ba1 J:3-317)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903313Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2903314Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2903387Family c.70.1.0: automated matches [191403] (1 protein)
    not a true family
  6. 2903388Protein automated matches [190539] (7 species)
    not a true protein
  7. 2903403Species Gardnerella vaginalis [TaxId:879307] [358801] (1 PDB entry)
  8. 2903413Domain d6ba1j1: 6ba1 J:3-317 [358940]
    Other proteins in same PDB: d6ba1a2, d6ba1b2, d6ba1c2, d6ba1d2, d6ba1e2, d6ba1f2, d6ba1g2, d6ba1h2, d6ba1i2, d6ba1j2, d6ba1k2, d6ba1l2, d6ba1m2, d6ba1n2, d6ba1o2, d6ba1p2, d6ba1q2, d6ba1r2
    automated match to d3mkna_
    complexed with ca

Details for d6ba1j1

PDB Entry: 6ba1 (more details), 2.9 Å

PDB Description: purine-preferring ribonucleoside hydrolase from gardnerella vaginalis
PDB Compounds: (J:) Inosine-uridine preferring nucleoside hydrolase

SCOPe Domain Sequences for d6ba1j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ba1j1 c.70.1.0 (J:3-317) automated matches {Gardnerella vaginalis [TaxId: 879307]}
klildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevkv
ykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkdl
vyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadilf
rsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggcg
lhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvprf
lnefmtrisglakia

SCOPe Domain Coordinates for d6ba1j1:

Click to download the PDB-style file with coordinates for d6ba1j1.
(The format of our PDB-style files is described here.)

Timeline for d6ba1j1:

  • d6ba1j1 first appeared in SCOPe 2.07, called d6ba1j_