Lineage for d6d4db_ (6d4d B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2454684Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2454892Protein automated matches [190252] (4 species)
    not a true protein
  7. 2454893Species Human (Homo sapiens) [TaxId:9606] [187034] (36 PDB entries)
  8. 3058873Domain d6d4db_: 6d4d B: [358935]
    automated match to d1yfoa_

Details for d6d4db_

PDB Entry: 6d4d (more details), 1.77 Å

PDB Description: crystal structure of the ptp epsilon d1 domain
PDB Compounds: (B:) receptor-type tyrosine-protein phosphatase epsilon

SCOPe Domain Sequences for d6d4db_:

Sequence, based on SEQRES records: (download)

>d6d4db_ c.45.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yfpipvehleeeirirsaddckqfreefnslpsghiqgtfelankeenreknrypnilpn
dhsrvilsqldgipcsdyinasyidgykeknkfiaaqgpkqetvndfwrmvweqksativ
mltnlkerkeekchqywpdqgcwtygnirvcvedcvvlvdytirkfciqpqlpdgckapr
lvsqlhftswpdfgvpftpigmlkflkkvktlnpvhagpivvhcsagvgrtgtfividam
mammhaeqkvdvfefvsrirnqrpqmvqtdmqytfiyqalleyylyg

Sequence, based on observed residues (ATOM records): (download)

>d6d4db_ c.45.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yfpipvehleeeirirsaddckqfreefnslpsghiqgtfelankeenreknrypnilpn
dhsrvilsqldgipcsdyinasyidgykeknkfiaaqgpkqetvndfwrmvweqksativ
mltnlkerkeekchqywpdqgcwtygnirvcvedcvvlvdytirkfciqpqaprlvsqlh
ftswpdfgvpftpigmlkflkkvktlnpvhagpivvhcsagvgrtgtfividammammha
eqkvdvfefvsrirnqrpqmvqtdmqytfiyqalleyylyg

SCOPe Domain Coordinates for d6d4db_:

Click to download the PDB-style file with coordinates for d6d4db_.
(The format of our PDB-style files is described here.)

Timeline for d6d4db_:

  • d6d4db_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18

View in 3D
Domains from other chains:
(mouse over for more information)
d6d4da_