Lineage for d6ekkd_ (6ekk D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (139 species)
    not a true protein
  7. 2452278Species Human (Homo sapiens) [TaxId:9606] [186862] (137 PDB entries)
  8. 3058861Domain d6ekkd_: 6ekk D: [358923]
    automated match to d3tw8d_
    complexed with edo, gdp, so4

Details for d6ekkd_

PDB Entry: 6ekk (more details), 1.82 Å

PDB Description: crystal structure of gef domain of dennd 1a in complex with rab gtpase rab35-gdp bound state.
PDB Compounds: (D:) Ras-related protein Rab-35

SCOPe Domain Sequences for d6ekkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ekkd_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dydhlfklliigdsgvgksslllrfadntfsgsyittigvdfkirtveingekvklqiwd
tagqerfrtitstyyrgthgvivvydvtsaesfvnvkrwlheinqncddvcrilvgnknd
dperkvvetedaykfagqmgiqlfetsakenvnveemfncitelvlrakkdnla

SCOPe Domain Coordinates for d6ekkd_:

Click to download the PDB-style file with coordinates for d6ekkd_.
(The format of our PDB-style files is described here.)

Timeline for d6ekkd_:

  • d6ekkd_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-18